Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Na+/K+-ATPase Rabbit mAb |
---|---|
Catalog No. | A11683 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0674 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Na+/K+-ATPase (P05023). |
---|---|
Sequence | MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGF |
Gene ID | |
Swiss Prot | |
Synonyms | CMT2DD; HOMGSMR2; Na+/K+-ATPase |
Calculated MW | 113kDa |
Observed MW | 113kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HeLa, 293T, C2C12, C6 |
Cellular location | Cell membrane, Melanosome, Multi-pass membrane protein. |
Customer validation | (Mouse fibroblast) WB(Mus musculus, Scylla, homo sapiens) IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A11683? Please let us know so that we can cite the reference in this datasheet.