제품 > 항체 > 단일클론항체(mAb)

Neurogranin (NRGN) Rabbit mAb (A22700)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity: Mouse, Rat

Western blot analysis of various lysates, using Neurogranin(NRGN) Rabbit mAb (A22700) at 1 : 1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Western blot analysis of lysates from Rat spleen, using Neurogranin(NRGN) Rabbit mAb (A22700) at 1 : 1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

ABclonal:Immunohistochemistry - Neurogranin (NRGN) Rabbit mAb (A22700)

Immunohistochemistry analysis of paraffin-embedded Mouse brain using Neurogranin (NRGN) Rabbit mAb (A22700) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	Neurogranin (NRGN) Rabbit mAb
Catalog No.	A22700
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC57532

Background

Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 2-78 of human Neurogranin (NRGN). (NP_001119653.1).
Sequence	DCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD
Gene ID
Swiss Prot
Synonyms	RC3; hng; Neurogranin (NRGN)
Calculated MW	8kDa
Observed MW	15kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse brain, Rat spleen
Cellular location	axon, cytosol, dendritic spine head, glutamatergic synapse, nucleus, postsynaptic density, postsynaptic membrane