제품 > 항체 > 단일클론항체(mAb)

Neutrophil Elastase (ELANE) Rabbit mAb (A8953)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using Neutrophil Elastase (ELANE) Rabbit mAb (A8953) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - Neutrophil Elastase (ELANE) Rabbit mAb (A8953)

Immunohistochemistry analysis of paraffin-embedded Mouse bone marrow using Neutrophil Elastase (ELANE) Rabbit mAb (A8953) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - Neutrophil Elastase (ELANE) Rabbit mAb (A8953)

Immunofluorescence analysis of paraffin-embedded human spleen using Neutrophil Elastase (ELANE) Rabbit mAb (A8953) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Neutrophil Elastase (ELANE) Rabbit mAb
Catalog No.	A8953
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1364

Background

Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode structurally similar proteins. The encoded preproprotein is proteolytically processed to generate the active protease. Following activation, this protease hydrolyzes proteins within specialized neutrophil lysosomes, called azurophil granules, as well as proteins of the extracellular matrix. The enzyme may play a role in degenerative and inflammatory diseases through proteolysis of collagen-IV and elastin. This protein also degrades the outer membrane protein A (OmpA) of E. coli as well as the virulence factors of such bacteria as Shigella, Salmonella and Yersinia. Mutations in this gene are associated with cyclic neutropenia and severe congenital neutropenia (SCN). This gene is present in a gene cluster on chromosome 19.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 167-267 of human Neutrophil Elastase (ELANE) (P08246).
Sequence	SVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH
Gene ID
Swiss Prot
Synonyms	GE; NE; HLE; HNE; ELA2; SCN1; PMN-E; Neutrophil Elastase (ELANE)
Calculated MW	29kDa
Observed MW	30kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	THP-1, U-937
Cellular location	cell surface, cytoplasm, cytosol, extracellular exosome, extracellular region, extracellular space, phagocytic vesicle.
Customer validation	WB(Homo sapiens, Mus musculus)