제품 > 항체 > 다중클론항체(pAb)

OAF Rabbit pAb (A13202)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using OAF Rabbit pAb (A13202) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	OAF Rabbit pAb
Catalog No.	A13202
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

OAF (Out At First Homolog) is a Protein Coding gene. Diseases associated with OAF include Spondylocarpotarsal Synostosis Syndrome and Excessive Tearing.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 28-150 of human OAF (NP_848602.1).
Sequence	APAELRVRVRLPDGQVTEESLQADSDADSISLELRKPDGTLVSFTADFKKDVKVFRALILGELEKGQSQFQALCFVTQLQHNEIIPSEAMAKLRQKNPRAVRQAEEVRGLEHLHMDVAVNFSQ
Gene ID
Swiss Prot
Synonyms	NS5ATP13TP2; OAF
Calculated MW	31kDa
Observed MW	30kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse brain, Mouse kidney, Rat brain
Cellular location