제품 > 항체 > 다중클론항체(pAb)

OsGSR1 Rabbit pAb (A19205)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Oryza sativa

Western blot analysis of extracts of various tissues from the japonica rice (Oryza sativa L.) variety Zhonghua 11, using OsGSR1 Rabbit pAb (A19205) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 600s.

Overview

Product name	OsGSR1 Rabbit pAb
Catalog No.	A19205
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

OsGSR1, a member of the GAST (GA-stimulated transcript) gene family, is induced by Gibberellins (GA)and repressed by brassinosteroids (BR). OsGSR1 plays important roles in both BR and GA pathways, and also mediates an interaction between the two signaling pathways.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of Oryza sativa OsGSR1. (Q53AN3).
Sequence	MASSTKIPFLLLAVLLLLSIAFPSEVMAGGRGRGGGGGGGVAGGGNLRPWECSPKCAGRCSNTQYKKACLTFCNKCCAKCLCVPPGTYGNKGACPCYNNW
Gene ID
Swiss Prot
Synonyms	Gsr1; OJ1001_B06.38; OsGSR1
Calculated MW	11kDa
Observed MW	15kDa

Applications

Reactivity	Oryza sativa
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	leaves (after flower), milk seeds
Cellular location