Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Oryza sativa
Western blot analysis of extracts of various tissues from the japonica rice (Oryza sativa L.) variety Zhonghua 11, using OsMKK4 Rabbit pAb (A20715) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.
| Product name | OsMKK4 Rabbit pAb |
|---|---|
| Catalog No. | A20715 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of Oryza sativa OsMKK4. (Q6K4Q0). |
|---|---|
| Sequence | GSGAGGTVWMVRHRPTGRPYALKVLYGNHDDAVRRQITREIAILRTAEHPAVVRCHGMYEQAGELQILLEYMDGGSLEGRRIASEAFLADVARQVLSGIAY |
| Gene ID | |
| Swiss Prot | |
| Synonyms | OJ1316_E06.24; OsMKK4 |
| Calculated MW | 40kDa |
| Observed MW | 40kDa |
| Reactivity | Oryza sativa |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | leaves, spikes |
| Cellular location | cytoplasm |
* For research use only. Not for therapeutic or diagnostic purposes.
