제품 > 항체 > 단일클론항체(mAb)

PABPC1 Rabbit mAb (A24646)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from 293F cells, using PABPC1 Rabbit mAb (A24646) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - PABPC1 Rabbit mAb (A24646)

Immunohistochemistry analysis of PABPC1 in paraffin-embedded human liver using PABPC1 Rabbit mAb (A24646) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of PABPC1 in paraffin-embedded rat kidney using PABPC1 Rabbit mAb (A24646) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - PABPC1 Rabbit mAb (A24646)

Confocal imaging of MCF7 cells using PABPC1 Rabbit mAb (A24646, at dilution of 1:200) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Confocal imaging of NIH/3T3 cells using PABPC1 Rabbit mAb (A24646, at dilution of 1:200) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Confocal imaging of PC-12 cells using PABPC1 Rabbit mAb (A24646, at dilution of 1:200) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

ABclonal:Immunoprecipitation - PABPC1 Rabbit mAb (A24646)

Immunoprecipitation analysis of 300ug extracts of 293F cells using 3ug PABPC1 antibody (A24646 1:100). Western blot was performed from the immunoprecipitate using PABPC1 antibody (A24646) at a dilition of 1:1000.

Overview

Product name	PABPC1 Rabbit mAb
Catalog No.	A24646
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63433

Background

This gene encodes a poly(A) binding protein. The protein shuttles between the nucleus and cytoplasm and binds to the 3' poly(A) tail of eukaryotic messenger RNAs via RNA-recognition motifs. The binding of this protein to poly(A) promotes ribosome recruitment and translation initiation; it is also required for poly(A) shortening which is the first step in mRNA decay. The gene is part of a small gene family including three protein-coding genes and several pseudogenes.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 390-490 of human PABPC1 (NP_002559.2).
Sequence	RAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTM
Gene ID
Swiss Prot
Synonyms	PAB1; PABP; PABP1; PABPC2; PABPL1; PABPC1
Calculated MW	71kDa
Observed MW	71kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:100 - 1:500 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	293F
Cellular location	Cytoplasm, Nucleus