제품 > 항체 > 다중클론항체(pAb)

PAK1/PAK2/PAK3 Rabbit pAb (A21090)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using PAK1/PAK2/PAK3 antibody (A21090) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	PAK1/PAK2/PAK3 Rabbit pAb
Catalog No.	A21090
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a family member of serine/threonine p21-activating kinases, known as PAK proteins. These proteins are critical effectors that link RhoGTPases to cytoskeleton reorganization and nuclear signaling, and they serve as targets for the small GTP binding proteins Cdc42 and Rac. This specific family member regulates cell motility and morphology. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2010]

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 350-450 of human PAK1/PAK2/PAK3 (NP_002567.3).
Sequence	GSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSL
Gene ID
Swiss Prot
Synonyms	PAKalpha
Calculated MW	65kDa
Observed MW	61kDa, 66-68kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	SH-SY5Y, HeLa, MCF7, Mouse testis, Rat testis, C6
Cellular location	cytoplasm, cytosol, focal adhesion, microtubule organizing center, nuclear membrane, nucleoplasm, plasma membrane, ruffle membrane, Z disc