PE Rabbit anti-Human/Mouse Nanog mAb (A26535)

Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

ABclonal:Flow CytoMetry - PE Rabbit anti-Human/Mouse Nanog mAb (A26535)

Flow cytometry: 1X10^6 NTERA-2 cells were intracellularly-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human/Mouse Nanog mAb (A26535, 5 μl/Test, right).

Flow cytometry: 1X10^6 F9 cells were intracellularly-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human/Mouse Nanog mAb (A26535, 5 μl/Test, right).

Overview

Product name	PE Rabbit anti-Human/Mouse Nanog mAb
Catalog No.	A26535
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62770-PE

The protein encoded by this gene is a DNA binding homeobox transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency. The encoded protein can block ES cell differentiation and can also autorepress its own expression in differentiating cells. Several transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 160-305 of mouse Nanog(NP_082292.1).
Sequence	LKTSNGLIQKGSAPVEYPSIHCSYPQGYLVNASGSLSMWGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQSWNGQPWNAAPLHNFGEDFLQPYVQLQQNFSASDLEVNLEATRESHAHFSTPQALELFLNYSVTPPGEI
Gene ID
Swiss Prot
Synonyms	ENK; Stm1; ecat4; 2410002E02Rik
Calculated MW	34kDa
Observed MW

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular location	nucleolus, nucleoplasm, nucleus, Nucleus.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PE Rabbit anti-Human/Mouse Nanog mAb images

Flow CytoMetry - PE Rabbit anti-Human/Mouse Nanog mAb (A26535)

Flow cytometry: 1X10^6 NTERA-2 cells were intracellularly-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human/Mouse Nanog mAb (A26535, 5 μl/Test, right).

Flow CytoMetry - PE Rabbit anti-Human/Mouse Nanog mAb (A26535)

Flow cytometry: 1X10^6 F9 cells were intracellularly-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human/Mouse Nanog mAb (A26535, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.