제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Mouse S100A9 mAb (A26914)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 RAW 264.7 cells (negative control, left) and C57BL/6 mouse splenocytes (right) were intracellularly-stained with PE Rabbit anti-Mouse S100A9 mAb (A26914, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 C57BL/6 mouse splenocytes were intracellularly-stained with ABflo® 450 Rabbit anti-Mouse CD11b mAb (A26229, 5 μl/Test) and PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Mouse S100A9 mAb (A26914, 5 μl/Test, right). Cells in the lymphocyte gate were used for analysis.

Overview

Product name	PE Rabbit anti-Mouse S100A9 mAb
Catalog No.	A26914
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC69927-PE

Background

Predicted to enable calcium ion binding activity and calcium-dependent protein binding activity. Involved in peptidyl-cysteine S-nitrosylation; positive regulation of blood coagulation; and regulation of translation. Acts upstream of or within several processes, including actin cytoskeleton reorganization; astrocyte development; and regulation of integrin biosynthetic process. Predicted to be located in cell junction; cytosol; and nucleoplasm. Predicted to be active in cytoplasm; extracellular space; and nucleus. Is expressed in several structures, including jaw; liver; otic capsule; skeleton; and spleen red pulp. Human ortholog(s) of this gene implicated in myocarditis. Orthologous to human S100A9 (S100 calcium binding protein A9).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-113 of mouse S100a9 (NP_033140.1).
Sequence	MANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK
Gene ID
Swiss Prot
Synonyms	p14; Cagb; GAGB; L1Ag; BEE22; MRP14; 60B8Ag
Calculated MW	13kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular location	Secreted, Cytoplasm. Cytoplasm , cytoskeleton, Cell membrane.