제품 > 항체 > 다중클론항체(pAb)

S100a9 Rabbit pAb (A25434)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from Mouse spleen using S100a9 Rabbit pAb(A25434) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - S100a9 Rabbit pAb (A25434)

Immunohistochemistry analysis of S100a9 in paraffin-embedded Human spleen tissue using S100a9 Rabbit pAb (A25434) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of S100a9 in paraffin-embedded Human esophagus tissue using S100a9 Rabbit pAb (A25434) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	S100a9 Rabbit pAb
Catalog No.	A25434
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable calcium ion binding activity and calcium-dependent protein binding activity. Involved in peptidyl-cysteine S-nitrosylation; positive regulation of blood coagulation; and regulation of translation. Acts upstream of or within several processes, including actin cytoskeleton reorganization; astrocyte development; and regulation of integrin biosynthetic process. Predicted to be located in cell junction; cytosol; and nucleoplasm. Predicted to be active in cytoplasm; extracellular space; and nucleus. Is expressed in several structures, including jaw; liver; otic capsule; skeleton; and spleen red pulp. Human ortholog(s) of this gene implicated in myocarditis. Orthologous to human S100A9 (S100 calcium binding protein A9).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-113 of mouse S100a9 (NP_033140.1).
Sequence	MANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK
Gene ID
Swiss Prot
Synonyms	p14; Cagb; GAGB; L1Ag; BEE22; MRP14; 60B8Ag
Calculated MW	13kDa
Observed MW	13kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse spleen
Cellular location	Secreted, Cytoplasm. Cytoplasm > cytoskeleton, Cell membrane.