제품 > 항체 > 다중클론항체(pAb)

PGLYRP2 Rabbit pAb (A17814)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of lysates from Mouse liver, using PGLYRP2 Rabbit pAb (A17814) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Overview

Product name	PGLYRP2 Rabbit pAb
Catalog No.	A17814
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. This protein hydrolyzes the link between N-acetylmuramoyl residues and L-amino acid residues in bacterial cell wall glycopeptides, and thus may play a scavenger role by digesting biologically active peptidoglycan into biologically inactive fragments.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 300-400 of human PGLYRP2 (NP_443122.3).
Sequence	LSQYYGAGVARDPGFRSNFRRQNGAALTSASILAQQVWGTLVLLQRLEPVHLQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLL
Gene ID
Swiss Prot
Synonyms	tagL; PGRPL; PGRP-L; PGLYRPL; HMFT0141; TAGL-like; tagl-beta; tagL-alpha; PGLYRP2
Calculated MW	62kDa
Observed MW	62kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse liver
Cellular location	extracellular exosome, extracellular region