Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | PI3 Kinase p85 alpha/beta Rabbit mAb |
---|---|
Catalog No. | A22487 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC57210 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human PI3 Kinase p85 alpha/beta (NP_852664.1). |
---|---|
Sequence | SVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQT |
Gene ID | |
Swiss Prot | |
Synonyms | PIK3R1/PIK3R2; PI3 Kinase p85 alpha/beta |
Calculated MW | 42-54kDa/81-84kDa |
Observed MW | 85kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Jurkat, NIH/3T3, Mouse brain |
Cellular location | cell-cell junction, cis-Golgi network, cytoplasm, cytosol, nucleus, perinuclear region of cytoplasm, plasma membrane |
Customer validation | WB(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22487? Please let us know so that we can cite the reference in this datasheet.