제품 > 항체 > 단일클론항체(mAb)

PI3 Kinase p85 alpha/beta/gamma mAb (A22996)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates, using PI3 Kinase p85 alpha/beta/gamma mAb (A22996) at 1:9000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

ABclonal:Immunofluorescence - PI3 Kinase p85 alpha/beta/gamma mAb (A22996)

Confocal imaging of NIH/3T3 cells using PI3 Kinase p85 alpha/beta/gamma Rabbit mAb(A22996, dilution 1:200) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (Blue). Objective: 60x.

Overview

Product name	PI3 Kinase p85 alpha/beta/gamma mAb
Catalog No.	A22996
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC57209

Background

Phosphatidylinositol 3-kinase phosphorylates the inositol ring of phosphatidylinositol at the 3-prime position. The enzyme comprises a 110 kD catalytic subunit and a regulatory subunit of either 85, 55, or 50 kD. This gene encodes the 85 kD regulatory subunit. Phosphatidylinositol 3-kinase plays an important role in the metabolic actions of insulin, and a mutation in this gene has been associated with insulin resistance. Alternative splicing of this gene results in four transcript variants encoding different isoforms. [provided by RefSeq, Jun 2011]

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 400-500 of human PI3 Kinase p85 alpha/beta (NP_852664.1).
Sequence	SVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQT
Gene ID
Swiss Prot
Synonyms	PIK3R1/PIK3R2/PIK3R3
Calculated MW	42-54kDa/81-84kDa
Observed MW	85kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:4500 - 1:18000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse brain
Cellular location	Golgi network, Cytoplasm, Cytosol, Nucleus, Perinuclear region of cytoplasm, Plasma membrane.
Customer validation	WB(Homo sapiens)