제품 > 항체 > 다중클론항체(pAb)

PIAS1 Rabbit pAb (A5729)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Immunofluorescence analysis of GFP-RNF168 transgenic U2OS cells using PIAS1 antibody (A5729). Green: GFP-RNF168 fusion protein expression for DNA damage marker. Blue: DAPI for nuclear staining. RNF168 (GFP) can be used to mark cells damaged by UV-A laser for they always gather around DNA damage region.

Immunofluorescence analysis of U2OS cells using PIAS1 antibody (A5729). Blue: DAPI for nuclear staining.

Overview

Product name	PIAS1 Rabbit pAb
Catalog No.	A5729
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the protein inhibitor of activated STAT (PIAS) family. PIAS proteins function as SUMO E3 ligases and play important roles in many cellular processes by mediating the sumoylation of target proteins. This protein plays a central role as a transcriptional coregulator of numerous cellular pathways includign the STAT1 and nuclear factor kappaB pathways. Alternate splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 422-651 of human PIAS1 (NP_057250.1).
Sequence	VQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTSLPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD
Gene ID
Swiss Prot
Synonyms	GBP; ZMIZ3; DDXBP1; GU/RH-II
Calculated MW	72kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location	Nucleus, Nucleus speckle, PML body