제품 > 항체 > 다중클론항체(pAb)

PIK3C3/VPS34 Rabbit pAb (A12483)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using PIK3C3/VPS34 antibody (A12483) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - PIK3C3/VPS34 Rabbit pAb (A12483)

Immunofluorescence analysis of NIH/3T3 cells using PIK3C3/VPS34 Rabbit pAb (A12483) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	PIK3C3/VPS34 Rabbit pAb
Catalog No.	A12483
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables 1-phosphatidylinositol-3-kinase activity. Involved in early endosome to late endosome transport and regulation of cytokinesis. Acts upstream of or within autophagy and protein lipidation. Located in autolysosome; late endosome; and midbody.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 130-412 of human PIK3C3/VPS34 (NP_002638.2).
Sequence	FGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIK
Gene ID
Swiss Prot
Synonyms	VPS34; Vps34; hVps34
Calculated MW	102kDa
Observed MW	100kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IHC-P 1:100 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	293T, C6, Mouse lung, Mouse brain, Rat brain
Cellular location	Cytoplasmic vesicle, Late endosome, Midbody, autophagosome
Customer validation	WB(Homo sapiens) IP(Nicotiana tabacum)