제품 > 항체 > 다중클론항체(pAb)

PIK3R3/p55PIK Rabbit pAb (A17322)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using PIK3R3/p55PIK Rabbit pAb (A17322) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - PIK3R3/p55PIK Rabbit pAb (A17322)

Immunofluorescence analysis of NIH-3T3 cells using PIK3R3/p55PIK Rabbit pAb (A17322) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	PIK3R3/p55PIK Rabbit pAb
Catalog No.	A17322
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Phosphatidylinositol 3-kinase (PI3K) phosphorylates phosphatidylinositol and similar compounds, which then serve as second messengers in growth signaling pathways. PI3K is composed of a catalytic and a regulatory subunit. The protein encoded by this gene represents a regulatory subunit of PI3K. The encoded protein contains two SH2 domains through which it binds activated protein tyrosine kinases to regulate their activity.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 300-388 of human PIK3R3/p55PIK (NP_003620.3).
Sequence	PDLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDADENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKK
Gene ID
Swiss Prot
Synonyms	p55; p55PIK; p55-GAMMA; PIK3R3/p55PIK
Calculated MW	54kDa
Observed MW	60kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:100 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	U-251MG, PC-3, 293T
Cellular location	cytosol
Customer validation	IHC(Mus musculus)