Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | PITX3 Rabbit mAb |
---|---|
Catalog No. | A19261 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2429 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PITX3 (O75364). |
---|---|
Sequence | MEFGLLSEAEARSPALSLSDAGTPHPQLPEHGCKGQEHSDSEKASASLPGGSPEDGSLKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTN |
Gene ID | |
Swiss Prot | |
Synonyms | ASMD; ASOD; PTX3; ASGD1; CTPP4; CTRCT11; PITX3 |
Calculated MW | 32kDa |
Observed MW | 35kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | C6, SH-SY5Y, U-87MG, Mouse eye |
Cellular location | Nucleus |
Customer validation | ELISA(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19261? Please let us know so that we can cite the reference in this datasheet.