Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | PKC alpha Rabbit mAb |
---|---|
Catalog No. | A23187 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC58853 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PKC alpha. (NP_002728.2). |
---|---|
Sequence | LIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME |
Gene ID | |
Swiss Prot | |
Synonyms | AAG6; PKCA; PRKACA; PKCI+/-; PKCalpha; PKC-alpha; PKC alpha |
Calculated MW | 77kDa |
Observed MW | 80kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, Jurkat, NIH/3T3, Mouse brain |
Cellular location | Cell membrane, Cytoplasm, Mitochondrion membrane, Nucleus, Peripheral membrane protein |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.