제품 > 항체 > 다중클론항체(pAb)

PKC alpha Rabbit pAb (A0267)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PKC alpha Rabbit pAb (A0267) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - PKC alpha Rabbit pAb (A0267)

Immunohistochemistry analysis of paraffin-embedded Human lung cancer using PKC alpha Rabbit pAb (A0267) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon using PKC alpha Rabbit pAb (A0267) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Review

Overview

Product name	PKC alpha Rabbit pAb
Catalog No.	A0267
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This kinase has been reported to play roles in many different cellular processes, such as cell adhesion, cell transformation, cell cycle checkpoint, and cell volume control. Knockout studies in mice suggest that this kinase may be a fundamental regulator of cardiac contractility and Ca(2+) handling in myocytes.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 573-672 of human PKC alpha (NP_002728.2).
Sequence	MTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
Gene ID
Swiss Prot
Synonyms	AAG6; PKCA; PRKACA; PKCI+/-; PKCalpha; PKC-alpha; PKC alpha
Calculated MW	77kDa
Observed MW	80kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	NIH/3T3, Jurkat, C6, SH-SY5Y, Mouse brain, Rat brain
Cellular location	Cell membrane, Cytoplasm, Mitochondrion membrane, Nucleus, Peripheral membrane protein.
Customer validation	(Rat cells) WB(Mus musculus, Gallus gallus, Rattus norvegicus)