제품 > 항체 > 단일클론항체(mAb)

PKC delta Rabbit mAb (A7778)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PKC delta Rabbit mAb (A7778) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunohistochemistry - PKC delta Rabbit mAb (A7778)

Immunohistochemistry analysis of PKC delta in paraffin-embedded human spleen tissue using PKC delta Rabbit mAb (A7778) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of PKC delta in paraffin-embedded mouse colon tissue using PKC delta Rabbit mAb (A7778) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of PKC delta in paraffin-embedded human thyroid tissue using PKC delta Rabbit mAb (A7778) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of PKC delta in paraffin-embedded mouse brain tissue using PKC delta Rabbit mAb (A7778) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of PKC delta in paraffin-embedded mouse testis tissue using PKC delta Rabbit mAb (A7778) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - PKC delta Rabbit mAb (A7778)

Immunofluorescence analysis of NIH-3T3 cells using PKC delta Rabbit mAb (A7778) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	PKC delta Rabbit mAb
Catalog No.	A7778
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1434

Background

The protein encoded by this gene is a member of the protein kinase C family of serine- and threonine-specific protein kinases. The encoded protein is activated by diacylglycerol and is both a tumor suppressor and a positive regulator of cell cycle progression. Also, this protein can positively or negatively regulate apoptosis. Defects in this gene are a cause of autoimmune lymphoproliferative syndrome.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 547-653 of human PKC delta (Q05655).
Sequence	PFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLID
Gene ID
Swiss Prot
Synonyms	MAY1; PKCD; ALPS3; CVID9; nPKC-delta; PKC delta
Calculated MW	78kDa
Observed MW	78kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, NIH/3T3, SH-SY5Y, Mouse brain, Rat brain
Cellular location	Cell membrane, Cytoplasm, Endoplasmic reticulum, Mitochondrion, Nucleus, Peripheral membrane protein, perinuclear region
Customer validation	WB(Homo sapiens)