제품 > 항체 > 단일클론항체(mAb)

PP1 beta Rabbit mAb (A4364)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PP1 beta Rabbit mAb (A4364) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - PP1 beta Rabbit mAb (A4364)

Immunohistochemistry analysis of PP1 beta in paraffin-embedded rat colon tissue using PP1 beta Rabbit mAb (A4364) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of PP1 beta in paraffin-embedded mouse colon tissue using PP1 beta Rabbit mAb (A4364) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of PP1 beta in paraffin-embedded human breast cancer tissue using PP1 beta Rabbit mAb (A4364) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of PP1 beta in paraffin-embedded human esophagus tissue using PP1 beta Rabbit mAb (A4364) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of PP1 beta in paraffin-embedded human pancreas tissue using PP1 beta Rabbit mAb (A4364) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - PP1 beta Rabbit mAb (A4364)

Immunofluorescence analysis of NIH-3T3 cells using PP1 beta Rabbit mAb (A4364) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using PP1 beta Rabbit mAb (A4364) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	PP1 beta Rabbit mAb
Catalog No.	A4364
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0981

Background

The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 228-327 of human PP1 beta (P62140).
Sequence	ADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
Gene ID
Swiss Prot
Synonyms	MP; PP1B; PP1c; NSLH2; PP-1B; PPP1CD; PP1beta; PPP1beta; HEL-S-80p; PP1 beta
Calculated MW	37kDa
Observed MW	37kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	PC-3, U-251MG, Mouse brain, Rat testis, Rat brain, Rat heart
Cellular location	Cytoplasm, Nucleus, Nucleolus, Nucleoplasm