제품 > 항체 > 단일클론항체(mAb)

PP2A-B56δ/PR61δ/PPP2R5D Rabbit mAb (A21122)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using PP2A-B56δ/PR61δ/PPP2R5D Rabbit mAb (A21122) at1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.

ABclonal:Immunohistochemistry - PP2A-B56δ/PR61δ/PPP2R5D Rabbit mAb (A21122)

Immunohistochemistry analysis of PP2A-B56δ/PR61δ/PPP2R5D in paraffin-embedded mouse colon tissue using PP2A-B56δ/PR61δ/PPP2R5D Rabbit mAb (A21122) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of PP2A-B56δ/PR61δ/PPP2R5D in paraffin-embedded rat colon tissue using PP2A-B56δ/PR61δ/PPP2R5D Rabbit mAb (A21122) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of PP2A-B56δ/PR61δ/PPP2R5D in paraffin-embedded human colon tissue using PP2A-B56δ/PR61δ/PPP2R5D Rabbit mAb (A21122) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	PP2A-B56δ/PR61δ/PPP2R5D Rabbit mAb
Catalog No.	A21122
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2981

Background

The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a delta isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 480-602 of human PPP2R5D (NP_006236.1).
Sequence	LFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEAL
Gene ID
Swiss Prot
Synonyms	B56D; MRD35; B56delta; PP2A-B56δ/PR61δ/PPP2R5D
Calculated MW	70kDa
Observed MW	66kDa/69kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HepG2, Mouse lung, Mouse brain, Rat testis, Rat brain
Cellular location	Cytoplasm, Nucleus