제품 > 항체 > 다중클론항체(pAb)

PP2A-B56δ/PR61δ/PPP2R5D Rabbit pAb (A15707)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PP2A-B56δ/PR61δ/PPP2R5D Rabbit pAb (A15707) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - PP2A-B56δ/PR61δ/PPP2R5D Rabbit pAb (A15707)

Immunohistochemistry analysis of paraffin-embedded rat brain using PP2A-B56δ/PR61δ/PPP2R5D Rabbit pAb (A15707) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using PP2A-B56δ/PR61δ/PPP2R5D Rabbit pAb (A15707) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse kidney using PP2A-B56δ/PR61δ/PPP2R5D Rabbit pAb (A15707) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - PP2A-B56δ/PR61δ/PPP2R5D Rabbit pAb (A15707)

Immunofluorescence analysis of L929 cells using PP2A-B56δ/PR61δ/PPP2R5D Rabbit pAb (A15707) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using PP2A-B56δ/PR61δ/PPP2R5D Rabbit pAb (A15707) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	PP2A-B56δ/PR61δ/PPP2R5D Rabbit pAb
Catalog No.	A15707
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a delta isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 450-550 of human PP2A-B56δ/PR61δ/PP2A-B56δ/PR61δ/PPP2R5D (NP_006236.1).
Sequence	LYRNSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRT
Gene ID
Swiss Prot
Synonyms	B56D; MRD35; B56delta; PP2A-B56δ/PR61δ/PPP2R5D
Calculated MW	70kDa
Observed MW	80kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:100 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HT-29, 293T, HeLa, Mouse heart, Mouse kidney, Rat kidney
Cellular location	Cytoplasm, Nucleus