Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of extracts of various cell lines, using PRK2/PRK2/PKN2 Rabbit mAb (A19746) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
| Product name | PRK2/PKN2 Rabbit mAb |
|---|---|
| Catalog No. | A19746 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC2274 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRK2/PKN2 (Q16513). |
|---|---|
| Sequence | MASNPERGEILLTELQGDSRSLPFSENVSAVQKLDFSDTMVQQKLDDIKDRIKREIRKELKIKEGAENLRKVTTDKKSLAYVDNILKKSNKKLEELHHKL |
| Gene ID | |
| Swiss Prot | |
| Synonyms | PAK2; PRK2; STK7; Pak-2; PRKCL2; PRO2042 |
| Calculated MW | 112kDa |
| Observed MW | 112kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | HeLa, NIH/3T3, Jurkat, C6 |
| Cellular location | Apical junction complex, Centrosome, Cytoplasm, Cytosol, Intermediate filament cytoskeleton, Nuclear body, Nucleoplasm, Nucleus, Perinuclear region of cytoplasm, Plasma membrane |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
