제품 > 항체 > 다중클론항체(pAb)

PRK2/PKN2 Rabbit pAb (A18373)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of lysates from Rat lung, using PRK2/PRK2/PKN2 Rabbit pAb (A18373) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	PRK2/PKN2 Rabbit pAb
Catalog No.	A18373
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables RNA polymerase binding activity; histone deacetylase binding activity; and protein serine/threonine kinase activity. Involved in several processes, including apical junction assembly; positive regulation of cell cycle; and positive regulation of viral genome replication. Located in several cellular components, including cleavage furrow; cytoskeleton; and midbody.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 600-700 of human PRK2/PRK2/PKN2 (NP_006247.1).
Sequence	GQDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFRCCAVLGRGHFGKVLLAEYKNTNEMFAIKALKKGDIVARDEVD
Gene ID
Swiss Prot
Synonyms	PAK2; PRK2; STK7; Pak-2; PRKCL2; PRO2042; PRK2/PKN2
Calculated MW	112kDa
Observed MW	140kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Rat lung
Cellular location	apical junction complex, centrosome, cytoplasm, cytosol, intermediate filament cytoskeleton, nuclear body, nucleoplasm, nucleus, perinuclear region of cytoplasm, plasma membrane