제품 > 항체 > 단일클론항체(mAb)

PSD93/chapsyn-110/DLG2 Rabbit mAb (A19669)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using PSD93/chapsyn-110/DLG2 Rabbit mAb (A19669) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - PSD93/chapsyn-110/DLG2 Rabbit mAb (A19669)

Immunofluorescence analysis of mouse brain cells using PSD93/chapsyn-110/DLG2 Rabbit mAb (A19669) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	PSD93/chapsyn-110/DLG2 Rabbit mAb
Catalog No.	A19669
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2222

Background

This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. The encoded protein forms a heterodimer with a related family member that may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described, but their full-length nature is not known.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 600-700 of human PSD93/chapsyn-110/DLG2 (Q15700).
Sequence	RRVERKERARLKTVKFNAKPGVIDSKGSFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPERGQEDLILSYEPVTRQEINYTRPVIILGPMKDRINDDLISE
Gene ID
Swiss Prot
Synonyms	PSD93; PSD-93; PPP1R58; chapsyn-110
Calculated MW	98kDa
Observed MW	110kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, C6, SH-SY5Y, U-251MG, Mouse lung, Mouse spinal cord, Mouse brain, Rat brain
Cellular location	Axon cytoplasm, basolateral plasma membrane, cytosol, neuromuscular junction, neuron projection, perikaryon, plasma membrane, postsynaptic density, postsynaptic density membrane
Customer validation	WB(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PSD93/chapsyn-110/DLG2 Rabbit mAb images

Western blot - PSD93/chapsyn-110/DLG2 Rabbit mAb (A19669)

Immunofluorescence - PSD93/chapsyn-110/DLG2 Rabbit mAb (A19669)

Immunofluorescence analysis of mouse brain cells using PSD93/chapsyn-110/DLG2 Rabbit mAb (A19669) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.