제품 > 항체 > 단일클론항체(mAb)

Pan Cadherin Rabbit mAb (A4903)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

ABclonal:Western blot - Pan Cadherin Rabbit mAb (A4903)

Western blot analysis of various lysates using Pan Cadherin Rabbit mAb (A4903) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - Pan Cadherin Rabbit mAb (A4903)

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using Pan Cadherin Rabbit mAb (A4903) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	Pan Cadherin Rabbit mAb
Catalog No.	A4903
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1135

Background

This gene encodes a classical cadherin of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion protein is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Mutations in this gene are correlated with gastric, breast, colorectal, thyroid and ovarian cancer. Loss of function of this gene is thought to contribute to cancer progression by increasing proliferation, invasion, and/or metastasis. The ectodomain of this protein mediates bacterial adhesion to mammalian cells and the cytoplasmic domain is required for internalization. This gene is present in a gene cluster with other members of the cadherin family on chromosome 16. [provided by RefSeq, Nov 2015]

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 806-906 of human Cadherin-2 (CDH2) (P19022).
Sequence	IRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
Gene ID
Swiss Prot
Synonyms	Arc-1; CD324; CDHE; ECAD; LCAM; UVO; Pan Cadherin
Calculated MW	140kDa
Observed MW	140kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, Mouse liver
Cellular location	actin cytoskeleton, adherens junction, apical junction complex, cell junction, cytoplasm, cytoplasmic side of plasma membrane, endosome, extracellular exosome, extracellular region, flotillin complex, glutamatergic synapse, lateral plasma membrane, perinuclear region of cytoplasm, plasma membrane, trans-Golgi network
Customer validation	WB(Homo sapiens)