Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Pannexin 1 Rabbit pAb |
---|---|
Catalog No. | A13587 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 297-426 of human Pannexin 1 (NP_056183.2). |
---|---|
Sequence | VPFRQKTDVLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC |
Gene ID | |
Swiss Prot | |
Synonyms | PX1; MRS1; OOMD7; OZEMA7; UNQ2529 |
Calculated MW | 48kDa |
Observed MW | 45kDa/60kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Mouse brain, Mouse ovary |
Cellular location | Cell junction, Cell membrane, Endoplasmic reticulum membrane, Multi-pass membrane protein, Multi-pass membrane protein, gap junction |
Customer validation | WB(Mus musculus, Oryctolagus cuniculus) IF(Oryctolagus cuniculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A13587? Please let us know so that we can cite the reference in this datasheet.