Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using Parvalbumin (PVALB) Rabbit pAb (A2791) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunohistochemistry analysis of paraffin-embedded Rat brain using Parvalbumin (PVALB) Rabbit pAb (A2791) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunofluorescence analysis of Human kidney tissue using Parvalbumin/PVALB Rabbit pAb (A2791) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining.
Immunofluorescence analysis of Mouse kidney tissue using Parvalbumin/PVALB Rabbit pAb (A2791) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining.
Immunofluorescence analysis of Mouse brain tissue using Parvalbumin/PVALB Rabbit pAb (A2791) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Microwave antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining.
Immunofluorescence analysis of Rat brain tissue using Parvalbumin/PVALB Rabbit pAb (A2791) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Microwave antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining.
| Product name | Parvalbumin/PVALB Rabbit pAb |
|---|---|
| Catalog No. | A2791 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human Parvalbumin (PVALB) (NP_002845.1). |
|---|---|
| Sequence | MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES |
| Gene ID | |
| Swiss Prot | |
| Synonyms | D22S749; Parvalbumin (PVALB) |
| Calculated MW | 12kDa |
| Observed MW | 15kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | Mouse skeletal muscle, Rat skeletal muscle |
| Cellular location | axon, cytoplasm, nucleus, synapse. |
| Customer validation | IF(Mus musculus) WB(Mus musculus) IF(Mus musculus) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A2791? Please let us know so that we can cite the reference in this datasheet.
