제품 > 항체 > 단일클론항체(mAb)

Prolyl hydroxylase PHD1 (EGLN2) Rabbit mAb (A3730)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using Prolyl hydroxylase PHD1 (EGLN2) Rabbit mAb (A3730) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Overview

Product name	Prolyl hydroxylase PHD1 (EGLN2) Rabbit mAb
Catalog No.	A3730
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0230

Background

The hypoxia inducible factor (HIF) is a transcriptional complex that is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. This gene encodes an enzyme responsible for this post-translational modification. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream RAB4B (RAB4B, member RAS oncogene family) gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Prolyl hydroxylase PHD1 (EGLN2) (Q96KS0).
Sequence	MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATSTTASPLRDGFGGQDGGELRPLQSEGAAALV
Gene ID
Swiss Prot
Synonyms	EIT6; PHD1; EIT-6; HPH-1; HPH-3; HIFPH1; HIF-PH1
Calculated MW	44kDa
Observed MW	44kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	A-549, MCF7, PC-3, Mouse lung, Mouse testis, Mouse brain, Rat testis, Rat brain
Cellular location	Nucleus
Customer validation	WB(Mus musculus) IF(Mus musculus)