제품 > 항체 > 다중클론항체(pAb)

Prolyl hydroxylase PHD1 (EGLN2) Rabbit pAb (A2252)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Prolyl hydroxylase PHD1 (EGLN2) Rabbit pAb (A2252) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunoprecipitation - Prolyl hydroxylase PHD1 (EGLN2) Rabbit pAb (A2252)

Immunoprecipitation analysis of 150 μg extracts of HeLa cells using 3 μg Prolyl hydroxylase PHD1 (Prolyl hydroxylase PHD1 (EGLN2)) antibody (A2252). Western blot was performed from the immunoprecipitate using Prolyl hydroxylase PHD1 (Prolyl hydroxylase PHD1 (EGLN2)) antibody (A2252) at a dilution of 1:1000.

Overview

Product name	Prolyl hydroxylase PHD1 (EGLN2) Rabbit pAb
Catalog No.	A2252
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The hypoxia inducible factor (HIF) is a transcriptional complex that is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. This gene encodes an enzyme responsible for this post-translational modification. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream RAB4B (RAB4B, member RAS oncogene family) gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Prolyl hydroxylase PHD1 (EGLN2)(NP_444274.1).
Sequence	AALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRTKAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT
Gene ID
Swiss Prot
Synonyms	EIT6; PHD1; EIT-6; HPH-1; HPH-3; HIFPH1; HIF-PH1; Prolyl hydroxylase PHD1 (EGLN2)
Calculated MW	44kDa
Observed MW	43kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HeLa, A-549, HepG2, U-87MG, MCF-7, Mouse brain, Rat heart
Cellular location	Nucleus.