제품 > 항체 > 단일클론항체(mAb)

RAB11A/B Rabbit mAb (A20996)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using RAB11A/B Rabbit mAb (A20996) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunofluorescence - RAB11A/B Rabbit mAb (A20996)

Immunofluorescence analysis of U2OS cells using RAB11A/B Rabbit mAb (A20996) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	RAB11A/B Rabbit mAb
Catalog No.	A20996
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC51971

Background

The protein encoded by this gene belongs to the Rab family of the small GTPase superfamily. It is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAB11A/B (NP_004654.1).
Sequence	MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYE
Gene ID
Swiss Prot
Synonyms	YL8; H-YPT3; NDAGSCW; RAB11A/B
Calculated MW	24KDa
Observed MW	24kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	A549, SH-SY5Y, Neuro-2a
Cellular location	Axon, Centriole, Centrosome, Cytoplasmic vesicle, Cytosol, Endosome, Extracellular exosome, Glutamatergic synapse, Golgi apparatus, Multivesicular body, Postsynaptic recycling endosome, Recycling endosome, Spindle pole, Trans-Golgi network