제품 > 항체 > 다중클론항체(pAb)

RAB20 Rabbit pAb (A17725)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of lysates from Mouse heart, using RAB20 Rabbit pAb (A17725) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

ABclonal:Immunofluorescence - RAB20 Rabbit pAb (A17725)

Immunofluorescence analysis of L929 cells using RAB20 Rabbit pAb (A17725) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	RAB20 Rabbit pAb
Catalog No.	A17725
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable GTPase activity. Involved in phagosome acidification and phagosome-lysosome fusion. Located in Golgi apparatus and phagocytic vesicle.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 80-190 of human RAB20 (NP_060287.1).
Sequence	YDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNV
Gene ID
Swiss Prot
Synonyms	RAB20
Calculated MW	26kDa
Observed MW	26kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse heart
Cellular location	Cytoplasmic side, Cytoplasmic vesicle, Golgi apparatus, Lipid-anchor, phagosome, phagosome membrane