Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of extracts of various cell lines, using RAB5C/RABL antibody (A20882) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of various cell lines, using RAB5C/RABL antibody (A20882) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunofluorescence analysis of A-549 cells using RAB5C / RABL Rabbit mAb (A20882) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
| Product name | RAB5C / RABL Rabbit mAb |
|---|---|
| Catalog No. | A20882 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC2829 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 2-216 of human RAB5C / RABL (P51148). |
|---|---|
| Sequence | AGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN |
| Gene ID | |
| Swiss Prot | |
| Synonyms | RABL; L1880; RAB5L; RAB5CL |
| Calculated MW | 23kDa |
| Observed MW | 25kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence Immunoprecipitation |
| Positive samples | HepG2, A549, SK-BR-3, U-937, Mouse lung, Mouse brain, Rat brain |
| Cellular location | Cell membrane, Cytoplasmic side, Early endosome membrane, Lipid-anchor, Melanosome |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
