Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | RAB8A Rabbit pAb |
---|---|
Catalog No. | A17369 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 140-207 of human RAB8A (NP_005361.2). |
---|---|
Sequence | ALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL |
Gene ID | |
Swiss Prot | |
Synonyms | MEL; RAB8 |
Calculated MW | 24kDa |
Observed MW | 24kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | HCT116, HeLa, C6 |
Cellular location | Cell membrane, Cell projection, Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Golgi apparatus, Lipid-anchor, Recycling endosome membrane, centriole, centrosome, cilium, cilium basal body, cytoskeleton, microtubule organizing center, phagosome, phagosome membrane |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.