제품 > 항체 > 단일클론항체(mAb)

RAB9A Rabbit mAb (A4894)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using RAB9A Rabbit mAb (A4894) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - RAB9A Rabbit mAb (A4894)

Immunohistochemistry analysis of paraffin-embedded Rat testis using RAB9A Rabbit mAb (A4894) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - RAB9A Rabbit mAb (A4894)

Confocal imaging of NIH/3T3 cells using RAB9A Rabbit mAb (A4894, dilution 1:100) (Green). The cells were counterstained with Alpha-tubulin (ubiquitous) chain Rabbit mAb (AC039, dilution 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 60x.

Overview

Product name	RAB9A Rabbit mAb
Catalog No.	A4894
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0332

Background

Enables GDP binding activity; GTP binding activity; and GTPase activity. Involved in negative regulation by host of symbiont catalytic activity; positive regulation of exocytosis; and regulation of protein localization. Located in late endosome; lysosome; and phagocytic vesicle.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAB9A (NP_004242.1).
Sequence	MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSN
Gene ID
Swiss Prot
Synonyms	RAB9; RAB9A
Calculated MW	23kDa
Observed MW	23kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, PC-12, Hep G2, NIH/3T3, Mouse lung, Mouse liver, Rat liver
Cellular location	Cell membrane, Cytoplasmic side, Cytoplasmic vesicle, Endoplasmic reticulum membrane, Golgi apparatus membrane, Late endosome, Lipid-anchor, phagosome, phagosome membrane
Customer validation	WB(Homo sapiens) IF(Sus scrofa)