제품 > 항체 > 단일클론항체(mAb)

RAIDD/CRADD Rabbit mAb (A8663)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of extracts of various cell lines, using RAIDD/CRADD Rabbit mAb (A8663) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - RAIDD/CRADD Rabbit mAb (A8663)

Immunofluorescence analysis of C6 cells using RAIDD/CRADD Rabbit mAb (A8663) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	RAIDD/CRADD Rabbit mAb
Catalog No.	A8663
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1770

Background

This gene encodes a protein containing a death domain (DD) motif. This protein recruits caspase 2/ICH1 to the cell death signal transduction complex, which includes tumor necrosis factor receptor 1 (TNFR1A) and RIPK1/RIP kinase, and acts in promoting apoptosis. A mutation in this gene was associated with cognitive disability. A related pseudogene is found on chromosome 3. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-199 of human RAIDD/CRADD (NP_003796.1).
Sequence	GDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE
Gene ID
Swiss Prot
Synonyms	MRT34; RAIDD
Calculated MW	23kDa
Observed MW	23kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HT-29, 293T, K-562
Cellular location	Cytoplasm, Nucleus