제품 > 항체 > 단일클론항체(mAb)

RBMX/hnRNP G Rabbit mAb (A21963)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using RBMX/hnRNP G Rabbit mAb (A21963) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - RBMX/hnRNP G Rabbit mAb (A21963)

Immunohistochemistry analysis of RBMX/hnRNP G in paraffin-embedded Human kidney tissue using RBMX/hnRNP G Rabbit mAb (A21963) at a dilution of 1:100 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of RBMX/hnRNP G in paraffin-embedded Human spleen tissue using RBMX/hnRNP G Rabbit mAb (A21963) at a dilution of 1:100 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of RBMX/hnRNP G in paraffin-embedded Rat spleen tissue using RBMX/hnRNP G Rabbit mAb (A21963) at a dilution of 1:100 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	RBMX/hnRNP G Rabbit mAb
Catalog No.	A21963
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC54054

Background

This gene belongs to the RBMY gene family which includes candidate Y chromosome spermatogenesis genes. This gene, an active X chromosome homolog of the Y chromosome RBMY gene, is widely expressed whereas the RBMY gene evolved a male-specific function in spermatogenesis. Pseudogenes of this gene, found on chromosomes 1, 4, 9, 11, and 6, were likely derived by retrotransposition from the original gene. Alternatively spliced transcript variants encoding different isoforms have been identified. A snoRNA gene (SNORD61) is found in one of its introns.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 292-391 of human RBMX/hnRNP G (NP_002130.2).
Sequence	RSAPPTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY
Gene ID
Swiss Prot
Synonyms	RNMX; HNRPG; HNRNPG; MRXS11; RBMXP1; RBMXRT; hnRNP-G; RBMX/hnRNP G
Calculated MW	42kDa
Observed MW	42kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:20000 IHC-P 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	K-562, Mouse thymus, Rat brain
Cellular location	Nucleus