제품 > 항체 > 단일클론항체(mAb)

RCHY1 Rabbit mAb (A19287)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of HCT116 cells, using RCHY1 antibody (A19287) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Overview

Product name	RCHY1 Rabbit mAb
Catalog No.	A19287
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2469

Background

The protein encoded by this gene has ubiquitin ligase activity. It mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including tumor protein 53, histone deacetylase 1, and cyclin-dependent kinase inhibitor 1B, thus regulating their levels and cell cycle progression. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 160-261 of human RCHY1 (Q96PM5).
Sequence	HVLPCGHLLHRTCYEEMLKEGYRCPLCMHSALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKCKICESYNTAQAGGRRISLDQQ
Gene ID
Swiss Prot
Synonyms	ZCHY; ARNIP; CHIMP; PIRH2; RNF199; ZNF363; PRO1996
Calculated MW	30kDa
Observed MW	30kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HCT116
Cellular location	Cytoplasm, Nucleus, Nucleus speckle