제품 > 항체 > 단일클론항체(mAb)

RPS6KA5 Rabbit mAb (A23891)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat, Monkey

Western blot analysis of various lysates, using RPS6KA5 Rabbit mAb (A23891) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	RPS6KA5 Rabbit mAb
Catalog No.	A23891
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61540

Background

Enables ATP binding activity and protein serine/threonine kinase activity. Involved in several processes, including histone-serine phosphorylation; positive regulation of histone modification; and regulation of transcription, DNA-templated. Located in cytoplasm and nucleoplasm.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 639-736 of human RPS6KA5 (NP_004746.2).
Sequence	TPDILGSSGAAVHTCVKATFHAFNKYKREGFCLQNVDKAPLAKRRKMKKTSTSTETRSSSSESSHSSSSHSHGKTTPTKTLQPSNPADSNNPETLFQFSDS
Gene ID
Swiss Prot
Synonyms	MSK1; RLPK; MSPK1; RPS6KA5
Calculated MW	62kDa/82kDa/90kDa
Observed MW	80kDa/100kDa

Applications

Reactivity	Human, Mouse, Rat, Monkey
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	SK-BR-3, C6
Cellular location	Cytoplasm, Nucleus.