제품 > 항체 > 다중클론항체(pAb)

RPS6KA5 Rabbit pAb (A5699)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of C6, using RPS6KA5 antibody (A5699) at 1:600 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	RPS6KA5 Rabbit pAb
Catalog No.	A5699
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables ATP binding activity and protein serine/threonine kinase activity. Involved in several processes, including histone-serine phosphorylation; positive regulation of histone modification; and regulation of transcription, DNA-templated. Located in cytoplasm and nucleoplasm.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 700-800 of human RPS6KA5 (NP_004746.2).
Sequence	TPDILGSSGAAVHTCVKATFHAFNKYKREGFCLQNVDKAPLAKRRKMKKTSTSTETRSSSSESSHSSSSHSHGKTTPTKTLQPSNPADSNNPETLFQFSDS
Gene ID
Swiss Prot
Synonyms	MSK1; RLPK; MSPK1
Calculated MW	90kDa
Observed MW	90kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	C6
Cellular location	Cytoplasm, Nucleus
Customer validation	WB(Homo sapiens, Mus musculus)