제품 > 항체 > 단일클론항체(mAb)

RXRB Rabbit mAb (A25648)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Chromatin immunoprecipitation was performed with 15 μg of cross-linked chromatin from HeLa cells transfected with a RXRB expression vector containing a single N-terminal flag-Tag, using 3 μg of RXRB Rabbit mAb (A25648) and IgG (AC042). The enrichment of immunoprecipitated DNA at different genomic loci was examined by quantitative PCR. The histogram compares the ratio of the immunoprecipitated DNA to the input at given loci.

Chromatin immunoprecipitation was performed with 15 μg of cross-linked chromatin from HeLa cells transfected with a RXRB expression vector containing a single C-terminal flag-Tag, using 3 μg of RXRB Rabbit mAb (A25648) and IgG (AC042). The enrichment of immunoprecipitated DNA at different genomic loci was examined by quantitative PCR. The histogram compares the ratio of the immunoprecipitated DNA to the input at given loci.

ABclonal:Western blot - RXRB Rabbit mAb (A25648)

Western blot analysis of lysates from Mouse spleen using RXRB Rabbit mAb (A25648) at 1:1500 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:45s.

ABclonal:Immunoprecipitation - RXRB Rabbit mAb (A25648)

Immunoprecipitation of RXRB from 600 µg extracts of Mouse thymus tissue was performed using 3 µg of RXRB Rabbit mAb (A25648). Rabbit IgG isotype control(AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using RXRB Rabbit mAb (A25648) at a dilution of 1:1000.

Overview

Product name	RXRB Rabbit mAb
Catalog No.	A25648
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61272

Background

This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). The encoded protein forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene lies within the major histocompatibility complex (MHC) class II region on chromosome 6. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RXRB (NP_068811.1).
Sequence	MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGVPPPSP
Gene ID
Swiss Prot
Synonyms	NR2B2; DAUDI6; RCoR-1; RXRbeta; H-2RIIBP; RXR-beta
Calculated MW	57kDa
Observed MW	72kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 3μg antibody for 10μg-15μg of Chromatin
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	Mouse spleen, Mouse thymus
Cellular location	cytoplasm, nucleoplasm, nucleus.