Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using RanGAP1 Rabbit mAb (A8758) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of RanGAP1 in paraffin-embedded rat testis tissue using RanGAP1 Rabbit mAb (A8758) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of RanGAP1 in paraffin-embedded mouse brain tissue using RanGAP1 Rabbit mAb (A8758) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of RanGAP1 in paraffin-embedded human colon carcinoma tissue using RanGAP1 Rabbit mAb (A8758) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of RanGAP1 in paraffin-embedded rat liver tissue using RanGAP1 Rabbit mAb (A8758) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of RanGAP1 in paraffin-embedded mouse kidney tissue using RanGAP1 Rabbit mAb (A8758) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of C6 cells using RanGAP1 Rabbit mAb (A8758) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using RanGAP1 Rabbit mAb (A8758) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | RanGAP1 Rabbit mAb |
|---|---|
| Catalog No. | A8758 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC1292 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RanGAP1 (P46060). |
|---|---|
| Sequence | MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPAL |
| Gene ID | |
| Swiss Prot | |
| Synonyms | SD; Fug1; RANGAP; RanGAP1 |
| Calculated MW | 64kDa |
| Observed MW | 65kDa/90kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | SKOV3, PC-3, C6, SH-SY5Y, NIH/3T3, Mouse liver, Mouse testis, Mouse brain, Rat testis |
| Cellular location | Chromosome, Cytoplasm, Cytoplasmic side, Nucleus membrane, Peripheral membrane protein, centromere, cytoskeleton, kinetochore, spindle pole |
| Customer validation | IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A8758? Please let us know so that we can cite the reference in this datasheet.
