제품 > 항체 > 다중클론항체(pAb)

RanGAP1 Rabbit pAb (A13347)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using RanGAP1 Rabbit pAb (A13347) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - RanGAP1 Rabbit pAb (A13347)

Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using RanGAP1 Rabbit pAb (A13347) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human placenta using RanGAP1 Rabbit pAb (A13347) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - RanGAP1 Rabbit pAb (A13347)

Immunofluorescence analysis of MCF-7 cells using RanGAP1 Rabbit pAb (A13347).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

Overview

Product name	RanGAP1 Rabbit pAb
Catalog No.	A13347
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a protein that associates with the nuclear pore complex and participates in the regulation of nuclear transport. The encoded protein interacts with Ras-related nuclear protein 1 (RAN) and regulates guanosine triphosphate (GTP)-binding and exchange. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 398-587 of human RanGAP1 (NP_002874.1).
Sequence	PQQRGQGEKSATPSRKILDPNTGEPAPVLSSPPPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Gene ID
Swiss Prot
Synonyms	SD; Fug1; RANGAP; RanGAP1
Calculated MW	64kDa
Observed MW	64/90kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	BT-474, HeLa, MCF7, SH-SY5Y, A-549, Jurkat
Cellular location	Chromosome, Cytoplasm, Cytoplasmic side, Nucleus membrane, Peripheral membrane protein, centromere, cytoskeleton, kinetochore, spindle pole

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

RanGAP1 Rabbit pAb images

Western blot - RanGAP1 Rabbit pAb (A13347)

Immunohistochemistry - RanGAP1 Rabbit pAb (A13347)

Immunofluorescence - RanGAP1 Rabbit pAb (A13347)

Immunofluorescence analysis of MCF-7 cells using RanGAP1 Rabbit pAb (A13347).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

* For research use only. Not for therapeutic or diagnostic purposes.