제품 > 항체 > 단일클론항체(mAb)

Rev-Erbα/NR1D1 Rabbit mAb (A20452)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Mouse liver, using Rev-Erbα/NR1D1 Rabbit mAb (A20452) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of various lysates using Rev-Erbα/NR1D1 Rabbit mAb (A20452) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from HepG2 cells, using Rev-Erbα/NR1D1 Rabbit mAb (A20452) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Overview

Product name	Rev-Erbα/NR1D1 Rabbit mAb
Catalog No.	A20452
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC50483

Background

This gene encodes a transcription factor that is a member of the nuclear receptor subfamily 1. The encoded protein is a ligand-sensitive transcription factor that negatively regulates the expression of core clock proteins. In particular this protein represses the circadian clock transcription factor aryl hydrocarbon receptor nuclear translocator-like protein 1 (ARNTL). This protein may also be involved in regulating genes that function in metabolic, inflammatory and cardiovascular processes.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 280-360 of human Rev-Erbα/NR1D1 (NP_068370.1).
Sequence	SPEPTVEDVISQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQRHNEALNGLRQ
Gene ID
Swiss Prot
Synonyms	EAR1; hRev; THRA1; THRAL; ear-1; REVERBA; REVERBalpha; Rev-Erbα/NR1D1
Calculated MW	67kDa
Observed MW	75kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Hep G2, Mouse liver, Rat brain, Rat lung
Cellular location	cytoplasm, dendrite, dendritic spine, nuclear body, nucleoplasm, nucleus.
Customer validation	IHC(Mus musculus) WB(Homo sapiens, Mus musculus, Rattus norvegicus)