제품 > 항체 > 단일클론항체(mAb)

Rhodopsin Rabbit mAb (A7245)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using Rhodopsin Rabbit mAb (A7245) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunohistochemistry - Rhodopsin Rabbit mAb (A7245)

Immunohistochemistry analysis of paraffin-embedded Mouse retina using Rhodopsin Rabbit mAb (A7245) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Overview

Product name	Rhodopsin Rabbit mAb
Catalog No.	A7245
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1818

Background

The protein encoded by this gene is found in rod cells in the back of the eye and is essential for vision in low-light conditions. The encoded protein binds to 11-cis retinal and is activated when light hits the retinal molecule. Defects in this gene are a cause of congenital stationary night blindness.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 249-348 of human Rhodopsin (NP_000530.1).
Sequence	EVTRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTIPAFFAKSAAIYNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATVSKTETSQVAPA
Gene ID
Swiss Prot
Synonyms	RP4; OPN2; CSNBAD1; Rhodopsin
Calculated MW	39kDa
Observed MW	28-150kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse eye, Rat eye
Cellular location	Membrane, Cell projection, cilium, photoreceptor outer segment
Customer validation	IF(Mus musculus) IHC(Mus musculus)