제품 > 항체 > 단일클론항체(mAb)

S100A9 Rabbit mAb (A22131)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates, using S100A9 Rabbit mAb (A22131) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - S100A9 Rabbit mAb (A22131)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using S100A9 Rabbit mAb (A22131) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human lung using S100A9 Rabbit mAb (A22131) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	S100A9 Rabbit mAb
Catalog No.	A22131
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC55864

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis. This antimicrobial protein exhibits antifungal and antibacterial activity.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human S100A9 (NP_002956.1).
Sequence	MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Gene ID
Swiss Prot
Synonyms	MIF; NIF; P14; CAGB; CFAG; CGLB; L1AG; LIAG; MRP14; 60B8AG; MAC387; S100-A9; S100A9
Calculated MW	13kDa
Observed MW	14kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	THP-1
Cellular location	cell junction, cytoplasm, cytoskeleton, cytosol, extracellular exosome, extracellular region, extracellular space, nucleoplasm, nucleus, plasma membrane.
Customer validation	ELISA(Homo sapiens) IHC(Homo sapiens)