Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | SERPINB4 Rabbit pAb |
---|---|
Catalog No. | A15316 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human SERPINB4 (NP_002965.1). |
---|---|
Sequence | RTMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAVVVVELSSPSTNEEFCCNHPFLFFIRQNKTNSILFYGRFSSP |
Gene ID | |
Swiss Prot | |
Synonyms | PI11; SCCA1; SCCA2; LEUPIN; SCCA-2; SERPINB4 |
Calculated MW | 45kDa |
Observed MW | 45kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse skin |
Cellular location | Cytoplasm |
Customer validation | WB(Other) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A15316? Please let us know so that we can cite the reference in this datasheet.