제품 > 항체 > 다중클론항체(pAb)

SGPL1 Rabbit pAb (A25695)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Immunohistochemistry analysis of SGPL1 in paraffin-embedded Human lung cancer tissue using SGPL1 Rabbit pAb (A25695) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of SGPL1 in paraffin-embedded Human liver cancer tissue using SGPL1 Rabbit pAb (A25695) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - SGPL1 Rabbit pAb (A25695)

Immunofluorescence analysis of Mouse small intestine tissue using SGPL1 Rabbit pAb (A25695) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining.

Immunofluorescence analysis of Rat thymus tissue using SGPL1 Rabbit pAb (A25695) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining.

Overview

Product name	SGPL1 Rabbit pAb
Catalog No.	A25695
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables sphinganine-1-phosphate aldolase activity. Involved in apoptotic signaling pathway; fatty acid metabolic process; and sphingolipid metabolic process. Located in endoplasmic reticulum. Implicated in nephrotic syndrome type 14.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 301-400 of human SGPL1 (NP_003892.2).
Sequence	VAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHKYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGI
Gene ID
Swiss Prot
Synonyms	SPL; S1PL; NPHS14
Calculated MW	64kDa
Observed MW	Refer to figures

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Immunohistochemistry Immunofluorescence
Positive samples
Cellular location	Endoplasmic reticulum membrane, Single-pass type III membrane protein